PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082305.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 698aa    MW: 77673.4 Da    PI: 6.7352
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082305.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.92.2e-24132233199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+kvlt sd++++g +++ +++a+e+       +  ++ +++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  XP_011082305.1 132 FCKVLTASDTSTHGGFSVLRRHANEClppldmtQ--QTPTQELIAKDLHGTEWHFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGE 222
                     99****************************9643..445569************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+v+v+r+
  XP_011082305.1 223 NGELRVGVRRH 233
                     999******97 PP

2Auxin_resp104.71.1e-34258337183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+ t+++F v+Y+Pr+  s+F++ ++k+++a+++++ +GmRfkm+fe+eds+err+sGt+vgv+d++p +W++SkWrsLk
  XP_011082305.1 258 ASHAVITNTMFVVYYKPRT--SQFIIGLNKYLEAMDHEFGIGMRFKMRFEGEDSPERRFSGTIVGVEDISP-HWKESKWRSLK 337
                     6899**************6..9***********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.5E-43122247IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.28E-41122261IPR015300DNA-binding pseudobarrel domain
CDDcd100171.31E-21130232No hitNo description
PROSITE profilePS5086312.365132234IPR003340B3 DNA binding domain
PfamPF023622.4E-22132233IPR003340B3 DNA binding domain
SMARTSM010192.1E-22132234IPR003340B3 DNA binding domain
PfamPF065073.9E-32258337IPR010525Auxin response factor
PfamPF023094.6E-11574671IPR033389AUX/IAA domain
SuperFamilySSF542771.28E-12585663No hitNo description
PROSITE profilePS5174525.274587668IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MANRGSFSQT QQFCSFSSEG SGGKDALYGE LWKACAGPLV DVPKKGERVY YFPQGHMEQL  60
EASTNQELNQ SIQMFNLPPK ILCRVFNILL LAEQDTDEVY AQITLMPEAD QTEPRSLDSN  120
PDEPPRPAVH SFCKVLTASD TSTHGGFSVL RRHANECLPP LDMTQQTPTQ ELIAKDLHGT  180
EWHFKHIFRG QPRRHLLTTG WSTFVTSKRL VAGDSFVFLR GENGELRVGV RRHARQQSSM  240
PSSVISSQSM HLGVLATASH AVITNTMFVV YYKPRTSQFI IGLNKYLEAM DHEFGIGMRF  300
KMRFEGEDSP ERRFSGTIVG VEDISPHWKE SKWRSLKVQW DEPASIPRPE RVSPWEIEPF  360
VASVPTALVQ PPTIKHHKRP RSHVEMPVPE TLTSTASPAW NLTHESHQIN RGFEGQRSNI  420
MANSHTKQDV TVAVMKHSSN NASSTHINGG RQSSACVNAS PNMIAEETEE NKSASAWSVV  480
SNYSSPSSGK QGNSPSSCLN NGMKPDTVAS CRLFGFDLRC PSVRTLCENS PLKSVDVPND  540
AGEVPSTVSS GDSDQKSAVS KDCRDSKQDQ LQAPTKEVQS RHSNSSRSRT KVQMQGVAVG  600
RAVDLTILKG YDDLITELEE MFEIKGELRP RNKWEIVFTD DEGDMMLMGD DPWPEFCNMV  660
RRIFICSSQD VKKMKGGKLP LPTAECEGTG INLENLAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-179173607355Auxin response factor 1
4ldw_A1e-179173607355Auxin response factor 1
4ldw_B1e-179173607355Auxin response factor 1
4ldx_A1e-179173607355Auxin response factor 1
4ldx_B1e-179173607355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082305.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A022Q6Q90.0A0A022Q6Q9_ERYGU; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9